SCOPe 2.08: Domain d1uikb2: 1uik B:351-535

Lineage for d1uikb2 (1uik B:351-535)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId:3847] [110313] (1 PDB entry)
   Uniprot Q7XXT2 204-621

8. Domain d1uikb2: 1uik B:351-535 [107881]
   complexed with mg

Details for d1uikb2

PDB Entry: 1uik, 2.3 Å

PDB Description: Crystal structure of soybean beta-conglycinin alpha prime homotrimer

PDB Compounds: (B:) alpha prime subunit of beta-conglycinin

SCOPe Domain Sequences for d1uikb2:

Sequence, based on SEQRES records:

>d1uikb2 b.82.1.2 (B:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}
ktissedkpfnlrsrdpiysnklgklfeitpeknpqlrdldvflsvvdmnegalflphfn
skaivvlvinegeanielvgikeqqqrqqqeeqplevrkyraelseqdifvipagypvvv
natsdlnffafginaennqrnflagskdnvisqipsqvqelafpgsakdienliksqses
yfvda

Sequence, based on observed residues (ATOM records):

>d1uikb2 b.82.1.2 (B:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}
ktissedkpfnlrsrdpiysnklgklfeitpeknpqlrdldvflsvvdmnegalflphfn
skaivvlvinegeanielvgilevrkyraelseqdifvipagypvvvnatsdlnffafgi
naennqrnflagskdnvisqipsqvqelafpgsakdienliksqsesyfvda

Timeline for d1uikb2:

• d1uikb2 first appeared in SCOP 1.69
  
• d1uikb2 appears in SCOPe 2.07