SCOPe 2.08: Domain d1tidd1: 1tid D:1-116

Lineage for d1tidd1 (1tid D:1-116)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.2: SpoIIaa-like [52091] (3 families)

5. Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)
   automatically mapped to Pfam PF01740

6. Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [110448] (4 PDB entries)
   Uniprot O32726 # 90% sequence identity

8. Domain d1tidd1: 1tid D:1-116 [107002]
   Other proteins in same PDB: d1tida_, d1tidb2, d1tidc_, d1tidd2
   complexed with atp, mg

Details for d1tidd1

PDB Entry: 1tid, 2.5 Å

PDB Description: crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: poised for phosphorylation complex with atp, crystal form i

PDB Compounds: (D:) anti-sigma f factor antagonist

SCOPe Domain Sequences for d1tidd1:

Sequence; same for both SEQRES and ATOM records:

>d1tidd1 c.13.2.1 (D:1-116) Anti-sigma factor antagonist SpoIIaa {Bacillus stearothermophilus [TaxId: 1422]}
mslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmdasg
lgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva

Timeline for d1tidd1:

• d1tidd1 first appeared in SCOP 1.69, called d1tidd_
  
• d1tidd1 appears in SCOPe 2.07