SCOP 1.69: Domain d1tidd_: 1tid D:

Lineage for d1tidd_ (1tid D:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.2: Anti-sigma factor antagonist SpoIIaa [52091] (1 family)

5. Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)

6. Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [110448] (4 PDB entries)

8. Domain d1tidd_: 1tid D: [107002]
   Other proteins in same PDB: d1tida_, d1tidc_

Details for d1tidd_

PDB Entry: 1tid, 2.5 Å

PDB Description: crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: poised for phosphorylation complex with atp, crystal form i

SCOP Domain Sequences for d1tidd_:

Sequence; same for both SEQRES and ATOM records:

>d1tidd_ c.13.2.1 (D:) Anti-sigma factor antagonist SpoIIaa {Bacillus stearothermophilus}
shmslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmda
sglgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva

Timeline for d1tidd_:

• d1tidd_ is new in SCOP 1.69
  
• d1tidd_ appears in SCOP 1.71
  
• d1tidd_ appears in the current release, SCOPe 2.08, called d1tidd1