![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
![]() | Superfamily c.13.2: SpoIIaa-like [52091] (3 families) ![]() |
![]() | Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein) automatically mapped to Pfam PF01740 |
![]() | Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [110448] (4 PDB entries) Uniprot O32726 # 90% sequence identity |
![]() | Domain d1tidb1: 1tid B:1-116 [107000] Other proteins in same PDB: d1tida_, d1tidb2, d1tidc_, d1tidd2 complexed with atp, mg |
PDB Entry: 1tid (more details), 2.5 Å
SCOPe Domain Sequences for d1tidb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tidb1 c.13.2.1 (B:1-116) Anti-sigma factor antagonist SpoIIaa {Bacillus stearothermophilus [TaxId: 1422]} mslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmdasg lgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva
Timeline for d1tidb1:
![]() Domains from other chains: (mouse over for more information) d1tida_, d1tidc_, d1tidd1, d1tidd2 |