![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.3: Histidine kinase [55884] (8 proteins) |
![]() | Protein Anti-sigma factor spoIIab [75535] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries) Uniprot O32727 |
![]() | Domain d1tidc_: 1tid C: [107001] Other proteins in same PDB: d1tidb1, d1tidb2, d1tidd1, d1tidd2 complexed with atp, mg |
PDB Entry: 1tid (more details), 2.5 Å
SCOPe Domain Sequences for d1tidc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tidc_ d.122.1.3 (C:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} nemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndpng ivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdeviv esevnkgttvylkk
Timeline for d1tidc_: