| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
Superfamily c.13.2: SpoIIaa-like [52091] (3 families) ![]() |
| Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein) automatically mapped to Pfam PF01740 |
| Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [110448] (4 PDB entries) Uniprot O32726 # 90% sequence identity |
| Domain d1tidd1: 1tid D:1-116 [107002] Other proteins in same PDB: d1tida_, d1tidb2, d1tidc_, d1tidd2 complexed with atp, mg |
PDB Entry: 1tid (more details), 2.5 Å
SCOPe Domain Sequences for d1tidd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tidd1 c.13.2.1 (D:1-116) Anti-sigma factor antagonist SpoIIaa {Bacillus stearothermophilus [TaxId: 1422]}
mslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmdasg
lgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva
Timeline for d1tidd1:
View in 3DDomains from other chains: (mouse over for more information) d1tida_, d1tidb1, d1tidb2, d1tidc_ |