Lineage for d1tida_ (1tid A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973838Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2973839Protein Anti-sigma factor spoIIab [75535] (1 species)
  7. 2973840Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries)
    Uniprot O32727
  8. 2973842Domain d1tida_: 1tid A: [106999]
    Other proteins in same PDB: d1tidb1, d1tidb2, d1tidd1, d1tidd2
    complexed with atp, mg

Details for d1tida_

PDB Entry: 1tid (more details), 2.5 Å

PDB Description: crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: poised for phosphorylation complex with atp, crystal form i
PDB Compounds: (A:) Anti-sigma F factor

SCOPe Domain Sequences for d1tida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tida_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]}
mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
ivesevnkgttvylkk

SCOPe Domain Coordinates for d1tida_:

Click to download the PDB-style file with coordinates for d1tida_.
(The format of our PDB-style files is described here.)

Timeline for d1tida_: