Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) |
Family d.122.1.3: Histidine kinase [55884] (5 proteins) |
Protein Anti-sigma factor spoIIab [75535] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries) |
Domain d1tida_: 1tid A: [106999] Other proteins in same PDB: d1tidb_, d1tidd_ |
PDB Entry: 1tid (more details), 2.5 Å
SCOP Domain Sequences for d1tida_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tida_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus} mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev ivesevnkgttvylkk
Timeline for d1tida_: