PDB entry 1tid

View 1tid on RCSB PDB site
Description: Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA: Poised for phosphorylation complex with ATP, crystal form I
Class: transcription
Keywords: SpoIIAB, SpoIIAA, anti-sigma, anti-anti-sigma, sporulation, serine kinase, TRANSCRIPTION
Deposited on 2004-06-02, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.235
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-sigma F factor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: SpoIIAB
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32727 (0-135)
      • modified residue (0)
      • modified residue (4)
      • see remark 999 (33)
      • modified residue (107)
      • modified residue (112)
      • modified residue (116)
    Domains in SCOPe 2.08: d1tida_
  • Chain 'B':
    Compound: anti-sigma f factor antagonist
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: SPOIIAA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32726 (3-118)
      • cloning artifact (0-2)
      • modified residue (3)
      • see remark 999 (15)
      • see remark 999 (31-39)
      • see remark 999 (42)
      • modified residue (58)
      • engineered (60)
      • modified residue (80)
      • modified residue (95)
    Domains in SCOPe 2.08: d1tidb1, d1tidb2
  • Chain 'C':
    Compound: Anti-sigma F factor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: SpoIIAB
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32727 (Start-135)
      • modified residue (4)
      • see remark 999 (33)
      • modified residue (107)
      • modified residue (112)
      • modified residue (116)
    Domains in SCOPe 2.08: d1tidc_
  • Chain 'D':
    Compound: anti-sigma f factor antagonist
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: SPOIIAA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32726 (3-118)
      • cloning artifact (1-2)
      • modified residue (3)
      • see remark 999 (15)
      • see remark 999 (31-39)
      • see remark 999 (42)
      • modified residue (58)
      • engineered (60)
      • modified residue (80)
      • modified residue (95)
    Domains in SCOPe 2.08: d1tidd1, d1tidd2
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tidA (A:)
mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
ivesevnkgttvylkk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tidB (B:)
gshmslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmd
asglgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >1tidC (C:)
mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
ivesevnkgttvylkk

    Sequence, based on observed residues (ATOM records): (download) 
    >1tidC (C:)
nemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndpng
ivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdeviv
esevnkgttvylkk

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >1tidD (D:)
gshmslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmd
asglgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva

    Sequence, based on observed residues (ATOM records): (download) 
    >1tidD (D:)
shmslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmda
sglgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva