SCOPe 2.08: Domain d1ti2e1: 1ti2 E:729-875

Lineage for d1ti2e1 (1ti2 E:729-875)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Transhydroxylase alpha subunit, AthL [110250] (1 species)

7. Species Pelobacter acidigallici [TaxId:35816] [110251] (6 PDB entries)
   Uniprot P80563

8. Domain d1ti2e1: 1ti2 E:729-875 [106934]
   Other proteins in same PDB: d1ti2a2, d1ti2b1, d1ti2b2, d1ti2c2, d1ti2d1, d1ti2d2, d1ti2e2, d1ti2f1, d1ti2f2, d1ti2g2, d1ti2h1, d1ti2h2, d1ti2i2, d1ti2j1, d1ti2j2, d1ti2k2, d1ti2l1, d1ti2l2
   complexed with 4mo, act, ca, mgd, sf4
   complexed with 4mo, act, ca, mgd, sf4

Details for d1ti2e1

PDB Entry: 1ti2, 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici

PDB Compounds: (E:) Pyrogallol hydroxytransferase large subunit

SCOPe Domain Sequences for d1ti2e1:

Sequence; same for both SEQRES and ATOM records:

>d1ti2e1 b.52.2.2 (E:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]}
kyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidaeargikngd
lirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggciniltpdryi
skyacgmanntalveiekwdgdkyeiy

Timeline for d1ti2e1:

• d1ti2e1 first appeared in SCOP 1.69
  
• d1ti2e1 appears in SCOPe 2.07