![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
![]() | Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
![]() | Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
![]() | Protein Transhydroxylase alpha subunit, AthL [110250] (1 species) |
![]() | Species Pelobacter acidigallici [TaxId:35816] [110251] (6 PDB entries) Uniprot P80563 |
![]() | Domain d1ti2g1: 1ti2 G:729-875 [106938] Other proteins in same PDB: d1ti2a2, d1ti2b1, d1ti2b2, d1ti2c2, d1ti2d1, d1ti2d2, d1ti2e2, d1ti2f1, d1ti2f2, d1ti2g2, d1ti2h1, d1ti2h2, d1ti2i2, d1ti2j1, d1ti2j2, d1ti2k2, d1ti2l1, d1ti2l2 complexed with 4mo, act, ca, mgd, sf4 complexed with 4mo, act, ca, mgd, sf4 |
PDB Entry: 1ti2 (more details), 2.35 Å
SCOPe Domain Sequences for d1ti2g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ti2g1 b.52.2.2 (G:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]} kyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidaeargikngd lirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggciniltpdryi skyacgmanntalveiekwdgdkyeiy
Timeline for d1ti2g1: