SCOPe 2.08: Domain d1ti2d2: 1ti2 D:1-195

Lineage for d1ti2d2 (1ti2 D:1-195)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)

7. Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)
   Uniprot P80564

8. Domain d1ti2d2: 1ti2 D:1-195 [106933]
   Other proteins in same PDB: d1ti2a1, d1ti2a2, d1ti2b1, d1ti2c1, d1ti2c2, d1ti2d1, d1ti2e1, d1ti2e2, d1ti2f1, d1ti2g1, d1ti2g2, d1ti2h1, d1ti2i1, d1ti2i2, d1ti2j1, d1ti2k1, d1ti2k2, d1ti2l1
   complexed with 4mo, act, ca, mgd, sf4
   complexed with 4mo, act, ca, mgd, sf4

Details for d1ti2d2

PDB Entry: 1ti2, 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici

PDB Compounds: (D:) Pyrogallol hydroxytransferase small subunit

SCOPe Domain Sequences for d1ti2d2:

Sequence; same for both SEQRES and ATOM records:

>d1ti2d2 d.58.1.5 (D:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

Timeline for d1ti2d2:

• d1ti2d2 first appeared in SCOP 1.69
  
• d1ti2d2 appears in SCOPe 2.07