PDB entry 1ti2

View 1ti2 on RCSB PDB site
Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici
Class: oxidoreductase
Keywords: Molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster, OXIDOREDUCTASE
Deposited on 2004-06-02, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.198
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyrogallol hydroxytransferase large subunit
    Species: Pelobacter acidigallici [TaxId:35816]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80563 (1-874)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1ti2a1, d1ti2a2
  • Chain 'B':
    Compound: Pyrogallol hydroxytransferase small subunit
    Species: Pelobacter acidigallici [TaxId:35816]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ti2b1, d1ti2b2
  • Chain 'C':
    Compound: Pyrogallol hydroxytransferase large subunit
    Species: Pelobacter acidigallici [TaxId:35816]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80563 (1-874)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1ti2c1, d1ti2c2
  • Chain 'D':
    Compound: Pyrogallol hydroxytransferase small subunit
    Species: Pelobacter acidigallici [TaxId:35816]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ti2d1, d1ti2d2
  • Chain 'E':
    Compound: Pyrogallol hydroxytransferase large subunit
    Species: Pelobacter acidigallici [TaxId:35816]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80563 (1-874)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1ti2e1, d1ti2e2
  • Chain 'F':
    Compound: Pyrogallol hydroxytransferase small subunit
    Species: Pelobacter acidigallici [TaxId:35816]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ti2f1, d1ti2f2
  • Chain 'G':
    Compound: Pyrogallol hydroxytransferase large subunit
    Species: Pelobacter acidigallici [TaxId:35816]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80563 (1-874)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1ti2g1, d1ti2g2
  • Chain 'H':
    Compound: Pyrogallol hydroxytransferase small subunit
    Species: Pelobacter acidigallici [TaxId:35816]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ti2h1, d1ti2h2
  • Chain 'I':
    Compound: Pyrogallol hydroxytransferase large subunit
    Species: Pelobacter acidigallici [TaxId:35816]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80563 (1-874)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1ti2i1, d1ti2i2
  • Chain 'J':
    Compound: Pyrogallol hydroxytransferase small subunit
    Species: Pelobacter acidigallici [TaxId:35816]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ti2j1, d1ti2j2
  • Chain 'K':
    Compound: Pyrogallol hydroxytransferase large subunit
    Species: Pelobacter acidigallici [TaxId:35816]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80563 (1-874)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1ti2k1, d1ti2k2
  • Chain 'L':
    Compound: Pyrogallol hydroxytransferase small subunit
    Species: Pelobacter acidigallici [TaxId:35816]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ti2l1, d1ti2l2
  • Heterogens: ACT, CA, MGD, 4MO, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti2A (A:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti2B (B:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti2C (C:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti2D (D:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti2E (E:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti2F (F:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti2G (G:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti2H (H:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti2I (I:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti2J (J:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti2K (K:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti2L (L:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl