![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species) |
![]() | Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries) Uniprot P80564 |
![]() | Domain d1ti2f2: 1ti2 F:1-195 [106937] Other proteins in same PDB: d1ti2a1, d1ti2a2, d1ti2b1, d1ti2c1, d1ti2c2, d1ti2d1, d1ti2e1, d1ti2e2, d1ti2f1, d1ti2g1, d1ti2g2, d1ti2h1, d1ti2i1, d1ti2i2, d1ti2j1, d1ti2k1, d1ti2k2, d1ti2l1 complexed with 4mo, act, ca, mgd, sf4 complexed with 4mo, act, ca, mgd, sf4 |
PDB Entry: 1ti2 (more details), 2.35 Å
SCOPe Domain Sequences for d1ti2f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ti2f2 d.58.1.5 (F:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel gtkprvyyknlyrfe
Timeline for d1ti2f2: