| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) ![]() |
| Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins) Pfam PF05738 |
| Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species) the penultimate strand is in the other beta-sheet than in the Cna repeats |
| Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries) Uniprot P80564 |
| Domain d1ti2j1: 1ti2 J:196-274 [106944] Other proteins in same PDB: d1ti2a1, d1ti2a2, d1ti2b2, d1ti2c1, d1ti2c2, d1ti2d2, d1ti2e1, d1ti2e2, d1ti2f2, d1ti2g1, d1ti2g2, d1ti2h2, d1ti2i1, d1ti2i2, d1ti2j2, d1ti2k1, d1ti2k2, d1ti2l2 complexed with 4mo, act, ca, mgd, sf4 complexed with 4mo, act, ca, mgd, sf4 |
PDB Entry: 1ti2 (more details), 2.35 Å
SCOPe Domain Sequences for d1ti2j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ti2j1 b.3.5.1 (J:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl
Timeline for d1ti2j1: