![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) ![]() automatically mapped to Pfam PF00988 |
![]() | Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein) |
![]() | Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52024] (10 PDB entries) Uniprot P00907 |
![]() | Domain d1t36h1: 1t36 H:2-152 [106331] Other proteins in same PDB: d1t36a1, d1t36a2, d1t36a3, d1t36a4, d1t36a5, d1t36a6, d1t36b2, d1t36c1, d1t36c2, d1t36c3, d1t36c4, d1t36c5, d1t36c6, d1t36d2, d1t36e1, d1t36e2, d1t36e3, d1t36e4, d1t36e5, d1t36e6, d1t36f2, d1t36g1, d1t36g2, d1t36g3, d1t36g4, d1t36g5, d1t36g6, d1t36h2 complexed with adp, cl, k, mn, net, orn, po4, u; mutant |
PDB Entry: 1t36 (more details), 2.1 Å
SCOPe Domain Sequences for d1t36h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t36h1 c.8.3.1 (H:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli [TaxId: 562]} iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl lrekgaqngciiagdnpdaalalekarafpg
Timeline for d1t36h1:
![]() Domains from other chains: (mouse over for more information) d1t36a1, d1t36a2, d1t36a3, d1t36a4, d1t36a5, d1t36a6, d1t36b1, d1t36b2, d1t36c1, d1t36c2, d1t36c3, d1t36c4, d1t36c5, d1t36c6, d1t36d1, d1t36d2, d1t36e1, d1t36e2, d1t36e3, d1t36e4, d1t36e5, d1t36e6, d1t36f1, d1t36f2, d1t36g1, d1t36g2, d1t36g3, d1t36g4, d1t36g5, d1t36g6 |