Lineage for d1t36e5 (1t36 E:128-402)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978554Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2978615Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 2978616Species Escherichia coli [TaxId:562] [56077] (10 PDB entries)
    Uniprot P00968
  8. 2978621Domain d1t36e5: 1t36 E:128-402 [106321]
    Other proteins in same PDB: d1t36a1, d1t36a2, d1t36a3, d1t36a4, d1t36b1, d1t36b2, d1t36c1, d1t36c2, d1t36c3, d1t36c4, d1t36d1, d1t36d2, d1t36e1, d1t36e2, d1t36e3, d1t36e4, d1t36f1, d1t36f2, d1t36g1, d1t36g2, d1t36g3, d1t36g4, d1t36h1, d1t36h2
    complexed with adp, cl, k, mn, net, orn, po4, u; mutant

Details for d1t36e5

PDB Entry: 1t36 (more details), 2.1 Å

PDB Description: crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate
PDB Compounds: (E:) Carbamoyl-phosphate synthase large chain

SCOPe Domain Sequences for d1t36e5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t36e5 d.142.1.2 (E:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]}
drrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsgggiaynree
feeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdamgihtgds
itvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviemnprvsrs
salaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkiprfnfekf
agandrlttqmksvgevmaigrtqqeslqkalrgl

SCOPe Domain Coordinates for d1t36e5:

Click to download the PDB-style file with coordinates for d1t36e5.
(The format of our PDB-style files is described here.)

Timeline for d1t36e5: