Lineage for d1t36c2 (1t36 C:936-1073)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859565Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859566Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2859567Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 2859568Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 2859569Species Escherichia coli [TaxId:562] [52338] (10 PDB entries)
    Uniprot P00968
  8. 2859571Domain d1t36c2: 1t36 C:936-1073 [106310]
    Other proteins in same PDB: d1t36a1, d1t36a3, d1t36a4, d1t36a5, d1t36a6, d1t36b1, d1t36b2, d1t36c1, d1t36c3, d1t36c4, d1t36c5, d1t36c6, d1t36d1, d1t36d2, d1t36e1, d1t36e3, d1t36e4, d1t36e5, d1t36e6, d1t36f1, d1t36f2, d1t36g1, d1t36g3, d1t36g4, d1t36g5, d1t36g6, d1t36h1, d1t36h2
    complexed with adp, cl, k, mn, net, orn, po4, u; mutant

Details for d1t36c2

PDB Entry: 1t36 (more details), 2.1 Å

PDB Description: crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate
PDB Compounds: (C:) Carbamoyl-phosphate synthase large chain

SCOPe Domain Sequences for d1t36c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t36c2 c.24.1.1 (C:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOPe Domain Coordinates for d1t36c2:

Click to download the PDB-style file with coordinates for d1t36c2.
(The format of our PDB-style files is described here.)

Timeline for d1t36c2: