Lineage for d1t36f1 (1t36 F:2-152)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851056Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) (S)
    automatically mapped to Pfam PF00988
  5. 2851057Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)
  6. 2851058Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)
  7. 2851059Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)
    Uniprot P00907
  8. 2851062Domain d1t36f1: 1t36 F:2-152 [106323]
    Other proteins in same PDB: d1t36a1, d1t36a2, d1t36a3, d1t36a4, d1t36a5, d1t36a6, d1t36b2, d1t36c1, d1t36c2, d1t36c3, d1t36c4, d1t36c5, d1t36c6, d1t36d2, d1t36e1, d1t36e2, d1t36e3, d1t36e4, d1t36e5, d1t36e6, d1t36f2, d1t36g1, d1t36g2, d1t36g3, d1t36g4, d1t36g5, d1t36g6, d1t36h2
    complexed with adp, cl, k, mn, net, orn, po4, u; mutant

Details for d1t36f1

PDB Entry: 1t36 (more details), 2.1 Å

PDB Description: crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate
PDB Compounds: (F:) Carbamoyl-phosphate synthase small chain

SCOPe Domain Sequences for d1t36f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t36f1 c.8.3.1 (F:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli [TaxId: 562]}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

SCOPe Domain Coordinates for d1t36f1:

Click to download the PDB-style file with coordinates for d1t36f1.
(The format of our PDB-style files is described here.)

Timeline for d1t36f1: