SCOPe 2.08: Domain d1sxjb2: 1sxj B:7-230

Lineage for d1sxjb2 (1sxj B:7-230)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Replication factor C4 [110568] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110569] (1 PDB entry)
   Uniprot P40339

8. Domain d1sxjb2: 1sxj B:7-230 [106084]
   Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2, d1sxjf1, d1sxjf2, d1sxjf3, d1sxjg1, d1sxjg2, d1sxjg3, d1sxjh1, d1sxjh2, d1sxjh3
   complexed with adp, ags, mg

Details for d1sxjb2

PDB Entry: 1sxj, 2.85 Å

PDB Description: crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)

PDB Compounds: (B:) Activator 1 37 kDa subunit

SCOPe Domain Sequences for d1sxjb2:

Sequence; same for both SEQRES and ATOM records:

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lqlpwvekyrpqvlsdivgnketidrlqqiakdgnmphmiisgmpgigkttsvhclahel
lgrsyadgvlelnasddrgidvvrnqikhfaqkklhlppgkhkivildeadsmtagaqqa
lrrtmelysnstrfafacnqsnkiieplqsqcailrysklsdedvlkrllqiikledvky
tndgleaiiftaegdmrqainnlqstvaghglvnadnvfkivds

Timeline for d1sxjb2:

• d1sxjb2 first appeared in SCOP 1.69
  
• d1sxjb2 appears in SCOPe 2.07