Lineage for d1sxjb2 (1sxj B:7-230)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 485481Family c.37.1.20: Extended AAA-ATPase domain [81269] (25 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 485667Protein Replication factor C4 [110568] (1 species)
  7. 485668Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110569] (1 PDB entry)
  8. 485669Domain d1sxjb2: 1sxj B:7-230 [106084]
    Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2, d1sxjf1, d1sxjf2, d1sxjg1, d1sxjg2, d1sxjh1, d1sxjh2

Details for d1sxjb2

PDB Entry: 1sxj (more details), 2.85 Å

PDB Description: Crystal Structure of the Eukaryotic Clamp Loader (Replication Factor C, RFC) Bound to the DNA Sliding Clamp (Proliferating Cell Nuclear Antigen, PCNA)

SCOP Domain Sequences for d1sxjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae)}
lqlpwvekyrpqvlsdivgnketidrlqqiakdgnmphmiisgmpgigkttsvhclahel
lgrsyadgvlelnasddrgidvvrnqikhfaqkklhlppgkhkivildeadsmtagaqqa
lrrtmelysnstrfafacnqsnkiieplqsqcailrysklsdedvlkrllqiikledvky
tndgleaiiftaegdmrqainnlqstvaghglvnadnvfkivds

SCOP Domain Coordinates for d1sxjb2:

Click to download the PDB-style file with coordinates for d1sxjb2.
(The format of our PDB-style files is described here.)

Timeline for d1sxjb2: