Lineage for d1sxja1 (1sxj A:548-693)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001760Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 2001761Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 2001762Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 protein domains)
    contains an extra helix
  6. 2001807Protein Replication factor C1 [109894] (1 species)
  7. 2001808Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109895] (1 PDB entry)
    Uniprot P38630 295-696 # helical segment (667-696) together with unassigned C-terminal sequence forms an all-alpha subdomain
  8. 2001809Domain d1sxja1: 1sxj A:548-693 [106081]
    Other proteins in same PDB: d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2, d1sxjf1, d1sxjf2, d1sxjf3, d1sxjg1, d1sxjg2, d1sxjg3, d1sxjh1, d1sxjh2, d1sxjh3
    complexed with adp, ags, mg

Details for d1sxja1

PDB Entry: 1sxj (more details), 2.85 Å

PDB Description: Crystal Structure of the Eukaryotic Clamp Loader (Replication Factor C, RFC) Bound to the DNA Sliding Clamp (Proliferating Cell Nuclear Antigen, PCNA)
PDB Compounds: (A:) Activator 1 95 kDa subunit

SCOPe Domain Sequences for d1sxja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxja1 a.80.1.1 (A:548-693) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
alkpfdiahkmldgqiysdigsrnftlndkialyfddfdftplmiqenylstrpsvlkpg
qshleavaeaancislgdivekkirsseqlwsllplhavlssvypaskvaghmagrinft
awlgqnsksakyyrllqeihyhtrlg

SCOPe Domain Coordinates for d1sxja1:

Click to download the PDB-style file with coordinates for d1sxja1.
(The format of our PDB-style files is described here.)

Timeline for d1sxja1: