Lineage for d1sxjf2 (1sxj F:127-256)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977029Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2977037Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (8 PDB entries)
    Uniprot P15873
  8. 2977049Domain d1sxjf2: 1sxj F:127-256 [106092]
    Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2, d1sxjf3, d1sxjg3, d1sxjh3
    complexed with adp, ags, mg

Details for d1sxjf2

PDB Entry: 1sxj (more details), 2.85 Å

PDB Description: crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)
PDB Compounds: (F:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d1sxjf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxjf2 d.131.1.2 (F:127-256) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkfnd

SCOPe Domain Coordinates for d1sxjf2:

Click to download the PDB-style file with coordinates for d1sxjf2.
(The format of our PDB-style files is described here.)

Timeline for d1sxjf2: