![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
![]() | Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (8 PDB entries) Uniprot P15873 |
![]() | Domain d1sxjg2: 1sxj G:127-255 [106094] Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2, d1sxjf3, d1sxjg3, d1sxjh3 complexed with adp, ags, mg |
PDB Entry: 1sxj (more details), 2.85 Å
SCOPe Domain Sequences for d1sxjg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxjg2 d.131.1.2 (G:127-255) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl qfflapkfn
Timeline for d1sxjg2: