Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein Stress sensor protease DegS, catalytic domain [110236] (1 species) |
Species Escherichia coli [TaxId:562] [110237] (12 PDB entries) Uniprot P31137 37-354 ! Uniprot P31137 |
Domain d1sozb2: 1soz B:43-254 [105862] Other proteins in same PDB: d1soza1, d1soza3, d1sozb1, d1sozb3, d1sozc1, d1sozc3 |
PDB Entry: 1soz (more details), 2.4 Å
SCOPe Domain Sequences for d1sozb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sozb2 b.47.1.1 (B:43-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdk sndgetpegigfaipfqlatkimdklirdgrv
Timeline for d1sozb2: