Lineage for d1sozc1 (1soz C:255-353)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2786418Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)
  6. 2786462Protein Stress sensor protease DegS, C-terminal domain [110188] (1 species)
  7. 2786463Species Escherichia coli [TaxId:562] [110189] (6 PDB entries)
    Uniprot P31137 37-354 ! Uniprot P31137
  8. 2786474Domain d1sozc1: 1soz C:255-353 [105863]
    Other proteins in same PDB: d1soza2, d1soza3, d1sozb2, d1sozb3, d1sozc2, d1sozc3
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1sozc1

PDB Entry: 1soz (more details), 2.4 Å

PDB Description: Crystal Structure of DegS protease in complex with an activating peptide
PDB Compounds: (C:) Protease degS

SCOPe Domain Sequences for d1sozc1:

Sequence, based on SEQRES records: (download)

>d1sozc1 b.36.1.4 (C:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}
irgyigiggreiaplhaqgggidqlqgivvnevspdgpaanagiqvndliisvdnkpais
aletmdqvaeirpgsvipvvvmrddkqltlqvtiqeypa

Sequence, based on observed residues (ATOM records): (download)

>d1sozc1 b.36.1.4 (C:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}
irggivvndliisvdnkpatmdqvaeirpgsviplqvtiqeypa

SCOPe Domain Coordinates for d1sozc1:

Click to download the PDB-style file with coordinates for d1sozc1.
(The format of our PDB-style files is described here.)

Timeline for d1sozc1: