Lineage for d1sozc2 (1soz C:43-254)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794586Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2794726Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)
  7. 2794727Species Escherichia coli [TaxId:562] [110237] (12 PDB entries)
    Uniprot P31137 37-354 ! Uniprot P31137
  8. 2794744Domain d1sozc2: 1soz C:43-254 [105864]
    Other proteins in same PDB: d1soza1, d1soza3, d1sozb1, d1sozb3, d1sozc1, d1sozc3

Details for d1sozc2

PDB Entry: 1soz (more details), 2.4 Å

PDB Description: Crystal Structure of DegS protease in complex with an activating peptide
PDB Compounds: (C:) Protease degS

SCOPe Domain Sequences for d1sozc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sozc2 b.47.1.1 (C:43-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad
qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy
nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdk
sndgetpegigfaipfqlatkimdklirdgrv

SCOPe Domain Coordinates for d1sozc2:

Click to download the PDB-style file with coordinates for d1sozc2.
(The format of our PDB-style files is described here.)

Timeline for d1sozc2: