Lineage for d1soza2 (1soz A:43-254)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)
  7. Species Escherichia coli [TaxId:562] [110237] (12 PDB entries)
    Uniprot P31137 37-354 ! Uniprot P31137
  8. Domain d1soza2: 1soz A:43-254 [105860]
    Other proteins in same PDB: d1soza1, d1soza3, d1sozb1, d1sozb3, d1sozc1, d1sozc3

Details for d1soza2

PDB Entry: 1soz (more details), 2.4 Å

PDB Description: Crystal Structure of DegS protease in complex with an activating peptide
PDB Compounds: (A:) Protease degS

SCOPe Domain Sequences for d1soza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1soza2 b.47.1.1 (A:43-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad
qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy
nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdk
sndgetpegigfaipfqlatkimdklirdgrv

SCOPe Domain Coordinates for d1soza2 are not available.

Timeline for d1soza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1soza1, d1soza3
View in 3D
Domains from other chains:
(mouse over for more information)
d1sozb1, d1sozb2, d1sozb3, d1sozc1, d1sozc2, d1sozc3