![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (14 proteins) |
![]() | Protein Stress sensor protease DegS, catalytic domain [110236] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [110237] (3 PDB entries) |
![]() | Domain d1sozb2: 1soz B:42-254 [105862] Other proteins in same PDB: d1soza1, d1sozb1, d1sozc1 |
PDB Entry: 1soz (more details), 2.4 Å
SCOP Domain Sequences for d1sozb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sozb2 b.47.1.1 (B:42-254) Stress sensor protease DegS, catalytic domain {Escherichia coli} mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd ksndgetpegigfaipfqlatkimdklirdgrv
Timeline for d1sozb2:
![]() Domains from other chains: (mouse over for more information) d1soza1, d1soza2, d1sozc1, d1sozc2 |