SCOP 1.69: Domain d1sozb2: 1soz B:42-254

Lineage for d1sozb2 (1soz B:42-254)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (14 proteins)

6. Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)

7. Species Escherichia coli [TaxId:562] [110237] (3 PDB entries)

8. Domain d1sozb2: 1soz B:42-254 [105862]
   Other proteins in same PDB: d1soza1, d1sozb1, d1sozc1

Details for d1sozb2

PDB Entry: 1soz, 2.4 Å

PDB Description: Crystal Structure of DegS protease in complex with an activating peptide

SCOP Domain Sequences for d1sozb2:

Sequence; same for both SEQRES and ATOM records:

>d1sozb2 b.47.1.1 (B:42-254) Stress sensor protease DegS, catalytic domain {Escherichia coli}
mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
ksndgetpegigfaipfqlatkimdklirdgrv

Timeline for d1sozb2:

• d1sozb2 is new in SCOP 1.69
  
• d1sozb2 appears in SCOP 1.71
  
• d1sozb2 appears in the current release, SCOPe 2.08