Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily) core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold |
Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) |
Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins) |
Protein Archaeal L30 (L30a) [55133] (1 species) long-chain member of the family; contains additional C-terminal (sub)domain |
Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (19 PDB entries) |
Domain d1s72w_: 1s72 W: [105342] Other proteins in same PDB: d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72x_, d1s72y_, d1s72z_ |
PDB Entry: 1s72 (more details), 2.4 Å
SCOP Domain Sequences for d1s72w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s72w_ d.59.1.1 (W:) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui} mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp prgghdgvkhpvkeggqlgkhdtegiddlleamr
Timeline for d1s72w_:
View in 3D Domains from other chains: (mouse over for more information) d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72x_, d1s72y_, d1s72z_ |