Lineage for d1s72g_ (1s72 G:)

  1. Root: SCOP 1.69
  2. 528313Class j: Peptides [58231] (116 folds)
  3. 529602Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 529603Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 529604Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 529605Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 529606Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (18 PDB entries)
  8. 529609Domain d1s72g_: 1s72 G: [105326]
    Other proteins in same PDB: d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_

Details for d1s72g_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution

SCOP Domain Sequences for d1s72g_:

Sequence, based on SEQRES records: (download)

>d1s72g_ j.84.1.1 (G:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1s72g_ j.84.1.1 (G:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d1s72g_:

Click to download the PDB-style file with coordinates for d1s72g_.
(The format of our PDB-style files is described here.)

Timeline for d1s72g_: