SCOP 1.69: Domain d1s72l_: 1s72 L:

Lineage for d1s72l_ (1s72 L:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
   core: three turns of irregular (beta-beta-alpha)n superhelix

4. Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family)

5. Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)

6. Protein Ribosomal protein L15 (L15p) [52082] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52083] (19 PDB entries)

8. Domain d1s72l_: 1s72 L: [105331]
   Other proteins in same PDB: d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_

Details for d1s72l_

PDB Entry: 1s72, 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution

SCOP Domain Sequences for d1s72l_:

Sequence, based on SEQRES records:

>d1s72l_ c.12.1.1 (L:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records):

>d1s72l_ c.12.1.1 (L:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

Timeline for d1s72l_:

• d1s72l_ is new in SCOP 1.69
  
• d1s72l_ appears in SCOP 1.71
  
• d1s72l_ appears in the current release, SCOPe 2.08