Lineage for d1s72l_ (1s72 L:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480304Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 480305Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 480306Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 480307Protein Ribosomal protein L15 (L15p) [52082] (1 species)
  7. 480308Species Archaeon Haloarcula marismortui [TaxId:2238] [52083] (19 PDB entries)
  8. 480311Domain d1s72l_: 1s72 L: [105331]
    Other proteins in same PDB: d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_

Details for d1s72l_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution

SCOP Domain Sequences for d1s72l_:

Sequence, based on SEQRES records: (download)

>d1s72l_ c.12.1.1 (L:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records): (download)

>d1s72l_ c.12.1.1 (L:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

SCOP Domain Coordinates for d1s72l_:

Click to download the PDB-style file with coordinates for d1s72l_.
(The format of our PDB-style files is described here.)

Timeline for d1s72l_: