Lineage for d1s72a2 (1s72 A:1-90)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 463443Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 463711Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (20 proteins)
    barrel, closed; n=5, S=8
  6. 463770Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
    incomplete OB-fold lacking the last strand
  7. 463771Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (19 PDB entries)
    includes the N-terminal tail
  8. 463774Domain d1s72a2: 1s72 A:1-90 [105319]
    Other proteins in same PDB: d1s72a1, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_

Details for d1s72a2

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution

SCOP Domain Sequences for d1s72a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72a2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvsaeiap

SCOP Domain Coordinates for d1s72a2:

Click to download the PDB-style file with coordinates for d1s72a2.
(The format of our PDB-style files is described here.)

Timeline for d1s72a2: