SCOP 1.69: Domain d1s72v_: 1s72 V:

Lineage for d1s72v_ (1s72 V:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.2: Long alpha-hairpin [46556] (14 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (19 PDB entries)

8. Domain d1s72v_: 1s72 V: [105341]
   Other proteins in same PDB: d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72w_, d1s72x_, d1s72y_, d1s72z_

Details for d1s72v_

PDB Entry: 1s72, 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution

SCOP Domain Sequences for d1s72v_:

Sequence; same for both SEQRES and ATOM records:

>d1s72v_ a.2.2.1 (V:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d1s72v_:

• d1s72v_ is new in SCOP 1.69
  
• d1s72v_ appears in SCOP 1.71
  
• d1s72v_ appears in the current release, SCOPe 2.08