Lineage for d1s72m_ (1s72 M:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499112Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 499113Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 499138Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
  6. 499139Protein Ribosomal protein L15e [54194] (1 species)
  7. 499140Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (19 PDB entries)
  8. 499143Domain d1s72m_: 1s72 M: [105332]
    Other proteins in same PDB: d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_

Details for d1s72m_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution

SCOP Domain Sequences for d1s72m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72m_ d.12.1.2 (M:) Ribosomal protein L15e {Archaeon Haloarcula marismortui}
arsaysyirdawenpgdgqlaelqwqrqqewrnegaverierptrldkarsqgykakqgv
ivarvsvrkgsarkrrhkagrrskrqgvtritrrkdiqrvaeerasrtfpnlrvlnsysv
gqdgrqkwhevilidpnhpaiqndddlswicaddqadrvfrgltgagrrnrglsgkgkgs
ektrpslrsnggka

SCOP Domain Coordinates for d1s72m_:

Click to download the PDB-style file with coordinates for d1s72m_.
(The format of our PDB-style files is described here.)

Timeline for d1s72m_: