SCOP 1.69: Domain d1s72u_: 1s72 U:

Lineage for d1s72u_ (1s72 U:)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (13 families)

5. Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)

6. Protein Ribosomal protein L24e [57750] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (19 PDB entries)

8. Domain d1s72u_: 1s72 U: [105340]
   Other proteins in same PDB: d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_

Details for d1s72u_

PDB Entry: 1s72, 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution

SCOP Domain Sequences for d1s72u_:

Sequence; same for both SEQRES and ATOM records:

>d1s72u_ g.39.1.6 (U:) Ribosomal protein L24e {Archaeon Haloarcula marismortui}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Timeline for d1s72u_:

• d1s72u_ is new in SCOP 1.69
  
• d1s72u_ appears in SCOP 1.71
  
• d1s72u_ appears in the current release, SCOPe 2.08