Lineage for d1rz4a1 (1rz4 A:132-216)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694159Family a.4.5.47: C-terminal part of PCI (proteasome COP9/signalosome eIF3) domains (PINT motif) [109671] (11 proteins)
    Pfam PF01399
    some members have long C-terminal tail with helix
  6. 2694172Protein Eukaryotic translation initiation factor 3 subunit 12, eIF3k, C-terminal domain [346009] (1 species)
  7. 2694173Species Human (Homo sapiens) [TaxId:9606] [346152] (1 PDB entry)
    Uniprot Q9UBQ5
  8. 2694174Domain d1rz4a1: 1rz4 A:132-216 [105131]
    Other proteins in same PDB: d1rz4a2
    complexed with so4

Details for d1rz4a1

PDB Entry: 1rz4 (more details), 2.1 Å

PDB Description: Crystal Structure of Human eIF3k
PDB Compounds: (A:) Eukaryotic translation initiation factor 3 subunit 11

SCOPe Domain Sequences for d1rz4a1:

Sequence, based on SEQRES records: (download)

>d1rz4a1 a.4.5.47 (A:132-216) Eukaryotic translation initiation factor 3 subunit 12, eIF3k, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tgfedsvrkfichvvgityqhidrwllaemlgdlsdsqlkvwmskygwsadesgqifics
qeesikpknivekidfdsvssimas

Sequence, based on observed residues (ATOM records): (download)

>d1rz4a1 a.4.5.47 (A:132-216) Eukaryotic translation initiation factor 3 subunit 12, eIF3k, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tgfedsvrkfichvvgityqhidrwllaemlgdlsdsqlkvwmskygwsadeqificsqe
esikpknivekidfdsvssimas

SCOPe Domain Coordinates for d1rz4a1:

Click to download the PDB-style file with coordinates for d1rz4a1.
(The format of our PDB-style files is described here.)

Timeline for d1rz4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rz4a2