Lineage for d1rz4a2 (1rz4 A:2-131)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. Family a.118.8.9: TPR-like repeats from PCI (proteasome / COP9 signalosome / eIF3) domains [345951] (10 proteins)
    N-terminal part of Pfam PF06272
    Described in PubMed 15180986 as 'HAM (HEAT analagous motif) domain'
    Probably homologous to TPR rather than HEAT, based on PubMed 15790418
  6. Protein Eukaryotic translation initiation factor 3 subunit 12, eIF3k, N-terminal domain [346010] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [346153] (1 PDB entry)
    Uniprot Q9UBQ5
  8. Domain d1rz4a2: 1rz4 A:2-131 [105132]
    Other proteins in same PDB: d1rz4a1
    complexed with so4

Details for d1rz4a2

PDB Entry: 1rz4 (more details), 2.1 Å

PDB Description: Crystal Structure of Human eIF3k
PDB Compounds: (A:) Eukaryotic translation initiation factor 3 subunit 11

SCOPe Domain Sequences for d1rz4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rz4a2 a.118.8.9 (A:2-131) Eukaryotic translation initiation factor 3 subunit 12, eIF3k, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
amfeqmranvgkllkgidrynpenlatleryvetqakenaydleanlavlklyqfnpaff
qttvtaqillkaltnlphtdftlckcmidqahqeerpirqilylgdlletchfqafwqal
denmdllegi

SCOPe Domain Coordinates for d1rz4a2 are not available.

Timeline for d1rz4a2:

Domains from same chain:
(mouse over for more information)
d1rz4a1