PDB entry 1rz4

View 1rz4 on RCSB PDB site
Description: Crystal Structure of Human eIF3k
Class: biosynthetic protein
Keywords: HEAT analogous motif, winged-helix, BIOSYNTHETIC PROTEIN
Deposited on 2003-12-23, released 2004-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.187
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 3 subunit 11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBQ5
      • modified residue (6)
      • modified residue (87)
      • modified residue (124)
      • modified residue (160)
      • modified residue (173)
      • modified residue (213)
    Domains in SCOPe 2.08: d1rz4a1, d1rz4a2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rz4A (A:)
    mamfeqmranvgkllkgidrynpenlatleryvetqakenaydleanlavlklyqfnpaf
    fqttvtaqillkaltnlphtdftlckcmidqahqeerpirqilylgdlletchfqafwqa
    ldenmdllegitgfedsvrkfichvvgityqhidrwllaemlgdlsdsqlkvwmskygws
    adesgqificsqeesikpknivekidfdsvssimassqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz4A (A:)
    amfeqmranvgkllkgidrynpenlatleryvetqakenaydleanlavlklyqfnpaff
    qttvtaqillkaltnlphtdftlckcmidqahqeerpirqilylgdlletchfqafwqal
    denmdllegitgfedsvrkfichvvgityqhidrwllaemlgdlsdsqlkvwmskygwsa
    deqificsqeesikpknivekidfdsvssimas