![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.47: C-terminal part of PCI (proteasome COP9/signalosome eIF3) domains (PINT motif) [109671] (11 proteins) Pfam PF01399 some members have long C-terminal tail with helix |
![]() | Protein Eukaryotic translation initiation factor 3 subunit 12, eIF3k, C-terminal domain [346009] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [346152] (1 PDB entry) Uniprot Q9UBQ5 |
![]() | Domain d1rz4a1: 1rz4 A:132-216 [105131] Other proteins in same PDB: d1rz4a2 complexed with so4 |
PDB Entry: 1rz4 (more details), 2.1 Å
SCOPe Domain Sequences for d1rz4a1:
Sequence, based on SEQRES records: (download)
>d1rz4a1 a.4.5.47 (A:132-216) Eukaryotic translation initiation factor 3 subunit 12, eIF3k, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} tgfedsvrkfichvvgityqhidrwllaemlgdlsdsqlkvwmskygwsadesgqifics qeesikpknivekidfdsvssimas
>d1rz4a1 a.4.5.47 (A:132-216) Eukaryotic translation initiation factor 3 subunit 12, eIF3k, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} tgfedsvrkfichvvgityqhidrwllaemlgdlsdsqlkvwmskygwsadeqificsqe esikpknivekidfdsvssimas
Timeline for d1rz4a1: