SCOPe 2.08: Domain d1re4e1: 1re4 E:200-458

Lineage for d1re4e1 (1re4 E:200-458)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families)

5. Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
   automatically mapped to Pfam PF00147

6. Protein Fibrinogen C-terminal domains [56498] (7 species)

7. Species Human (Homo sapiens), beta [TaxId:9606] [68903] (14 PDB entries)
   Uniprot P02675

8. Domain d1re4e1: 1re4 E:200-458 [104907]
   Other proteins in same PDB: d1re4a_, d1re4b2, d1re4c2, d1re4d_, d1re4e2, d1re4f2
   complexed with ca, nag

Details for d1re4e1

PDB Entry: 1re4, 2.7 Å

PDB Description: crystal structure of fragment d of bbetad398a fibrinogen

PDB Compounds: (E:) fibrinogen beta chain

SCOPe Domain Sequences for d1re4e1:

Sequence; same for both SEQRES and ATOM records:

>d1re4e1 d.171.1.1 (E:200-458) Fibrinogen C-terminal domains {Human (Homo sapiens), beta [TaxId: 9606]}
scnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgs
vdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkg
dkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstyd
rdndgwltsdprkqcskeagggwwynrchaanpngryywggqytwdmakhgtddgvvwmn
wkgswysmrkmsmkirpff

Timeline for d1re4e1:

• d1re4e1 first appeared in SCOP 1.69
  
• d1re4e1 appears in SCOPe 2.07