Lineage for d1re4f1 (1re4 F:142-393)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3002834Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 3002835Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 3002836Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 3002837Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 3002882Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (21 PDB entries)
    Uniprot P02679
  8. 3002904Domain d1re4f1: 1re4 F:142-393 [104909]
    Other proteins in same PDB: d1re4a_, d1re4b2, d1re4c2, d1re4d_, d1re4e2, d1re4f2
    complexed with ca, nag

Details for d1re4f1

PDB Entry: 1re4 (more details), 2.7 Å

PDB Description: crystal structure of fragment d of bbetad398a fibrinogen
PDB Compounds: (F:) Fibrinogen gamma chain

SCOPe Domain Sequences for d1re4f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re4f1 d.171.1.1 (F:142-393) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma [TaxId: 9606]}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrlt

SCOPe Domain Coordinates for d1re4f1:

Click to download the PDB-style file with coordinates for d1re4f1.
(The format of our PDB-style files is described here.)

Timeline for d1re4f1: