![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily) unusual fold |
![]() | Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) ![]() |
![]() | Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins) automatically mapped to Pfam PF00147 |
![]() | Protein Fibrinogen C-terminal domains [56498] (7 species) |
![]() | Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (21 PDB entries) Uniprot P02679 |
![]() | Domain d1re4c1: 1re4 C:142-393 [104904] Other proteins in same PDB: d1re4a_, d1re4b2, d1re4c2, d1re4d_, d1re4e2, d1re4f2 complexed with ca, nag |
PDB Entry: 1re4 (more details), 2.7 Å
SCOPe Domain Sequences for d1re4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1re4c1 d.171.1.1 (C:142-393) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma [TaxId: 9606]} tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk ttmkiipfnrlt
Timeline for d1re4c1: