Lineage for d1re4a_ (1re4 A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039948Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 3039949Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 3039950Protein Fibrinogen alpha chain [88887] (4 species)
  7. 3039959Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries)
    Uniprot P02671 150-209
  8. 3039977Domain d1re4a_: 1re4 A: [104901]
    Other proteins in same PDB: d1re4b1, d1re4b2, d1re4c1, d1re4c2, d1re4e1, d1re4e2, d1re4f1, d1re4f2
    complexed with ca, nag

Details for d1re4a_

PDB Entry: 1re4 (more details), 2.7 Å

PDB Description: crystal structure of fragment d of bbetad398a fibrinogen
PDB Compounds: (A:) Fibrinogen alpha/alpha-E Chain

SCOPe Domain Sequences for d1re4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re4a_ h.1.8.1 (A:) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
eqvia

SCOPe Domain Coordinates for d1re4a_:

Click to download the PDB-style file with coordinates for d1re4a_.
(The format of our PDB-style files is described here.)

Timeline for d1re4a_: