Lineage for d1re4e2 (1re4 E:166-199)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039948Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 3039949Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 3040014Protein Fibrinogen beta chain [88892] (4 species)
  7. 3040023Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
    Uniprot P02675
  8. 3040037Domain d1re4e2: 1re4 E:166-199 [104908]
    Other proteins in same PDB: d1re4a_, d1re4b1, d1re4c1, d1re4c2, d1re4d_, d1re4e1, d1re4f1, d1re4f2
    complexed with ca, nag

Details for d1re4e2

PDB Entry: 1re4 (more details), 2.7 Å

PDB Description: crystal structure of fragment d of bbetad398a fibrinogen
PDB Compounds: (E:) fibrinogen beta chain

SCOPe Domain Sequences for d1re4e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re4e2 h.1.8.1 (E:166-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
rvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOPe Domain Coordinates for d1re4e2:

Click to download the PDB-style file with coordinates for d1re4e2.
(The format of our PDB-style files is described here.)

Timeline for d1re4e2: