Lineage for d1re4e1 (1re4 E:200-458)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 514798Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 514799Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 514800Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 514801Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 514808Species Human (Homo sapiens), beta [TaxId:9606] [68903] (14 PDB entries)
  8. 514820Domain d1re4e1: 1re4 E:200-458 [104907]
    Other proteins in same PDB: d1re4a_, d1re4b2, d1re4c2, d1re4d_, d1re4e2, d1re4f2

Details for d1re4e1

PDB Entry: 1re4 (more details), 2.7 Å

PDB Description: crystal structure of fragment d of bbetad398a fibrinogen

SCOP Domain Sequences for d1re4e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re4e1 d.171.1.1 (E:200-458) Fibrinogen C-terminal domains {Human (Homo sapiens), beta}
scnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgs
vdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkg
dkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstyd
rdndgwltsdprkqcskeagggwwynrchaanpngryywggqytwdmakhgtddgvvwmn
wkgswysmrkmsmkirpff

SCOP Domain Coordinates for d1re4e1:

Click to download the PDB-style file with coordinates for d1re4e1.
(The format of our PDB-style files is described here.)

Timeline for d1re4e1: