SCOPe 2.08: Domain d1q0qa2: 1q0q A:1-125,A:275-300

Lineage for d1q0qa2 (1q0q A:1-125,A:275-300)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species)

7. Species Escherichia coli [TaxId:562] [69411] (11 PDB entries)
   Uniprot P45568

8. Domain d1q0qa2: 1q0q A:1-125,A:275-300 [104465]
   Other proteins in same PDB: d1q0qa1, d1q0qa3, d1q0qb1, d1q0qb3
   complexed with dxp, ndp

Details for d1q0qa2

PDB Entry: 1q0q, 1.9 Å

PDB Description: crystal structure of dxr in complex with the substrate 1-deoxy-d- xylulose-5-phosphate

PDB Compounds: (A:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1q0qa2:

Sequence; same for both SEQRES and ATOM records:

>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]}
mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
llankXdmrtpiahtmawpnrvnsgvkpldfc

Timeline for d1q0qa2:

• d1q0qa2 first appeared in SCOP 1.69
  
• d1q0qa2 appears in SCOPe 2.07