PDB entry 1q0q

View 1q0q on RCSB PDB site
Description: Crystal structure of DXR in complex with the substrate 1-deoxy-D-xylulose-5-phosphate
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2003-07-17, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: Escherichia coli [TaxId:562]
    Gene: dxr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0qa1, d1q0qa2, d1q0qa3
  • Chain 'B':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: Escherichia coli [TaxId:562]
    Gene: dxr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0qb1, d1q0qb2, d1q0qb3
  • Heterogens: DXP, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q0qA (A:)
    hhhhhhsgmkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspr
    yavmddeasakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptla
    airagktillankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyad
    leqngvvsilltgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgley
    iearwlfnasasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvns
    gvkpldfcklsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqir
    ftdiaalnlsvlekmdmrepqcvddvlsvdanarevarkevmrlas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q0qA (A:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q0qB (B:)
    hhhhhhsgmkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspr
    yavmddeasakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptla
    airagktillankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyad
    leqngvvsilltgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgley
    iearwlfnasasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvns
    gvkpldfcklsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqir
    ftdiaalnlsvlekmdmrepqcvddvlsvdanarevarkevmrlas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q0qB (B:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas