Lineage for d1q0qb1 (1q0q B:301-398)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717707Superfamily a.69.3: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69055] (1 family) (S)
  5. 2717708Family a.69.3.1: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69056] (1 protein)
  6. 2717709Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69057] (2 species)
  7. 2717710Species Escherichia coli [TaxId:562] [69058] (11 PDB entries)
    Uniprot P45568
  8. 2717714Domain d1q0qb1: 1q0q B:301-398 [104467]
    Other proteins in same PDB: d1q0qa2, d1q0qa3, d1q0qb2, d1q0qb3
    complexed with dxp, ndp

Details for d1q0qb1

PDB Entry: 1q0q (more details), 1.9 Å

PDB Description: crystal structure of dxr in complex with the substrate 1-deoxy-d- xylulose-5-phosphate
PDB Compounds: (B:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1q0qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0qb1 a.69.3.1 (B:301-398) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli [TaxId: 562]}
klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
lsvlekmdmrepqcvddvlsvdanarevarkevmrlas

SCOPe Domain Coordinates for d1q0qb1:

Click to download the PDB-style file with coordinates for d1q0qb1.
(The format of our PDB-style files is described here.)

Timeline for d1q0qb1: