Lineage for d1q0qb3 (1q0q B:126-274)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2962012Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2962013Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (2 species)
  7. 2962014Species Escherichia coli [TaxId:562] [69771] (11 PDB entries)
    Uniprot P45568
  8. 2962018Domain d1q0qb3: 1q0q B:126-274 [104469]
    Other proteins in same PDB: d1q0qa1, d1q0qa2, d1q0qb1, d1q0qb2
    complexed with dxp, ndp
    has additional insertions and/or extensions that are not grouped together

Details for d1q0qb3

PDB Entry: 1q0q (more details), 1.9 Å

PDB Description: crystal structure of dxr in complex with the substrate 1-deoxy-d- xylulose-5-phosphate
PDB Compounds: (B:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1q0qb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0qb3 d.81.1.3 (B:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]}
eslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltg
sggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfnasasq
mevlihpqsvihsmvryqdgsvlaqlgep

SCOPe Domain Coordinates for d1q0qb3:

Click to download the PDB-style file with coordinates for d1q0qb3.
(The format of our PDB-style files is described here.)

Timeline for d1q0qb3: